Recombinant Human VSNL1 protein, GST-tagged
Cat.No. : | VSNL1-3757H |
Product Overview : | Recombinant Human VSNL1 protein(P62760)(1-191aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-191aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49 kDa |
AA Sequence : | MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | VSNL1 visinin-like 1 [ Homo sapiens ] |
Official Symbol | VSNL1 |
Synonyms | VSNL1; visinin-like 1; visinin-like protein 1; hippocalcin like protein 3; HLP3; HPCAL3; HUVISL1; VILIP; VILIP 1; VLP-1; hippocalcin-like protein 3; VILIP-1; |
Gene ID | 7447 |
mRNA Refseq | NM_003385 |
Protein Refseq | NP_003376 |
MIM | 600817 |
UniProt ID | P62760 |
◆ Recombinant Proteins | ||
VSNL1-549H | Recombinant Human VSNL1 Protein, His-tagged | +Inquiry |
VSNL1-236H | Recombinant Human Visinin-Like 1, His-tagged | +Inquiry |
VSNL1-3757H | Recombinant Human VSNL1 protein, GST-tagged | +Inquiry |
VSNL1-1406H | Recombinant Human Visinin-like 1 | +Inquiry |
VSNL1-6566H | Recombinant Human VSNL1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSNL1-378HCL | Recombinant Human VSNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VSNL1 Products
Required fields are marked with *
My Review for All VSNL1 Products
Required fields are marked with *
0
Inquiry Basket