Recombinant Human VSNL1 protein, GST-tagged

Cat.No. : VSNL1-3757H
Product Overview : Recombinant Human VSNL1 protein(P62760)(1-191aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
ProteinLength : 1-191aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 49 kDa
AA Sequence : MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name VSNL1 visinin-like 1 [ Homo sapiens ]
Official Symbol VSNL1
Synonyms VSNL1; visinin-like 1; visinin-like protein 1; hippocalcin like protein 3; HLP3; HPCAL3; HUVISL1; VILIP; VILIP 1; VLP-1; hippocalcin-like protein 3; VILIP-1;
Gene ID 7447
mRNA Refseq NM_003385
Protein Refseq NP_003376
MIM 600817
UniProt ID P62760

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VSNL1 Products

Required fields are marked with *

My Review for All VSNL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon