Recombinant Human VSIG4 Protein, Fc-tagged

• Cat.No.: VSIG4-055H
• Product Overview: Recombinant Human VSIG4 fused with Fc His tag at C-termina was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Description: This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Molecular Mass: 56.3kD
• AA Sequence: RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: VSIG4 V-set and immunoglobulin domain containing 4 [ Homo sapiens ]
• Official Symbol: VSIG4
• Synonyms: VSIG4; V-set and immunoglobulin domain containing 4; V-set and immunoglobulin domain-containing protein 4; Z39IG; protein Z39Ig; Ig superfamily protein; complement receptor of the immunoglobulin superfamily; CRIg
• Gene ID: 11326
• mRNA Refseq: NM_001100431
• Protein Refseq: NP_001093901
• MIM: 300353
• UniProt ID: Q9Y279