Recombinant Human VSIG2 Protein, His-tagged

• Cat.No.: VSIG2-3911H
• Product Overview: Recombinant Human VSIG2 protein(Val24-Ala243), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Val24-Ala243
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 25 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAAHHHHHHHHHH

Gene Information

• Gene Name: VSIG2 V-set and immunoglobulin domain containing 2 [ Homo sapiens ]
• Official Symbol: VSIG2
• Synonyms: VSIG2; V-set and immunoglobulin domain containing 2; V-set and immunoglobulin domain-containing protein 2; CTH; CTXL; CT-like protein; cortical thymocyte-like protein; cortical thymocyte receptor (X. laevis CTX) like; 2210413P10Rik
• Gene ID: 23584
• mRNA Refseq: NM_014312
• Protein Refseq: NP_055127
• MIM: 606011
• UniProt ID: Q96IQ7