Recombinant Human VPS50 Protein, GST-Tagged

Cat.No. : VPS50-0524H
Product Overview : Human VPS50 full-length ORF (NP_078829.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : VPS50 (VPS50, EARP/GARPII Complex Subunit) is a Protein Coding gene.
Molecular Mass : 63.7 kDa
AA Sequence : MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTVCSDLITIHISLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name VPS50 VPS50, EARP/GARPII complex subunit [ Homo sapiens (human) ]
Official Symbol VPS50
Synonyms VPS50; VPS50, EARP/GARPII complex subunit; CCDC132; coiled-coil domain containing 132; coiled-coil domain-containing protein 132; DKFZp313I2429; FLJ20097; KIAA1861; FLJ23581; MGC176659;
Gene ID 55610
mRNA Refseq NM_001257998
Protein Refseq NP_001244927
UniProt ID Q96JG6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VPS50 Products

Required fields are marked with *

My Review for All VPS50 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon