Recombinant Human VPS50 Protein, GST-Tagged
Cat.No. : | VPS50-0524H |
Product Overview : | Human VPS50 full-length ORF (NP_078829.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | VPS50 (VPS50, EARP/GARPII Complex Subunit) is a Protein Coding gene. |
Molecular Mass : | 63.7 kDa |
AA Sequence : | MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTVCSDLITIHISLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | VPS50 VPS50, EARP/GARPII complex subunit [ Homo sapiens (human) ] |
Official Symbol | VPS50 |
Synonyms | VPS50; VPS50, EARP/GARPII complex subunit; CCDC132; coiled-coil domain containing 132; coiled-coil domain-containing protein 132; DKFZp313I2429; FLJ20097; KIAA1861; FLJ23581; MGC176659; |
Gene ID | 55610 |
mRNA Refseq | NM_001257998 |
Protein Refseq | NP_001244927 |
UniProt ID | Q96JG6 |
◆ Native Proteins | ||
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS30-1135HCL | Recombinant Human MRPS30 cell lysate | +Inquiry |
ART4-1541MCL | Recombinant Mouse ART4 cell lysate | +Inquiry |
MDA-MB-231-055HCL | Human MDA-MB-231 Whole Cell Lysate | +Inquiry |
Small Intestine-145R | Rat Small Intestine Tissue Lysate | +Inquiry |
ANKRD45-8849HCL | Recombinant Human ANKRD45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VPS50 Products
Required fields are marked with *
My Review for All VPS50 Products
Required fields are marked with *
0
Inquiry Basket