Recombinant Human VIP protein, His-tagged
Cat.No. : | VIP-3327H |
Product Overview : | Recombinant Human VIP protein(81-152 aa), fused to His tag, was expressed in E. coli. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-152 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | VIP vasoactive intestinal peptide [ Homo sapiens ] |
Official Symbol | VIP |
Synonyms | VIP; vasoactive intestinal peptide; VIP peptides; PHM27; MGC13587; |
Gene ID | 7432 |
mRNA Refseq | NM_003381 |
Protein Refseq | NP_003372 |
MIM | 192320 |
UniProt ID | P01282 |
◆ Recombinant Proteins | ||
VIP-623H | Recombinant Human VIP Protein, His-tagged | +Inquiry |
VIP-6431Z | Recombinant Zebrafish VIP | +Inquiry |
VIP-6564H | Recombinant Human VIP Protein (Tyr29-Pro165), His tagged | +Inquiry |
VIP-5158R | Recombinant Rhesus monkey VIP Protein, His-tagged | +Inquiry |
VIP-18019M | Recombinant Mouse VIP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VIP-1039HCL | Recombinant Human VIP cell lysate | +Inquiry |
VIP-408HCL | Recombinant Human VIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VIP Products
Required fields are marked with *
My Review for All VIP Products
Required fields are marked with *
0
Inquiry Basket