Recombinant Human VIP

• Cat.No.: VIP-30160TH
• Product Overview: Recombinant full length Human VIP isoform 2 with a proprietary tag: predicted molecular weight 44.66 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 169 amino acids
• Description: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
• Molecular Weight: 44.660kDa inclusive of tags
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
• Sequence Similarities: Belongs to the glucagon family.

Gene Information

• Gene Name: VIP vasoactive intestinal peptide [ Homo sapiens ]
• Official Symbol: VIP
• Synonyms: VIP; vasoactive intestinal peptide; VIP peptides
• Gene ID: 7432
• mRNA Refseq: NM_003381
• Protein Refseq: NP_003372
• MIM: 192320
• Uniprot ID: P01282
• Chromosome Location: 6q24-q27
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Glucagon-type ligand receptors, organism-specific biosystem
• Function: neuropeptide hormone activity