Recombinant Human VGLL3 Protein (1-320 aa), His-tagged

• Cat.No.: VGLL3-1555H
• Product Overview: Recombinant Human VGLL3 Protein (1-320 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-320 aa
• Description: May act as a specific coactivator for the mammalian TEFs.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.2 kDa
• AA Sequence: MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: VGLL3 vestigial like 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: VGLL3
• Synonyms: VGLL3; VGL 3; vestigial-like 3; VGL3; VGL-3; FLJ38507; DKFZp686O1845
• Gene ID: 389136
• mRNA Refseq: NM_016206
• Protein Refseq: NP_057290
• MIM: 609980
• UniProt ID: A8MV65