Recombinant Human VCAM1 protein, T7-tagged

• Cat.No.: VCAM1-179H
• Product Overview: Recombinant human DNAL4 (463aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 463 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro DNAL4 related cellular cargo movement regulation study coating with intracellular protein delivery of this protein.2. May be used as enzymatic subtrate protein for kinase and ubiquitin assay development.3. May be used for mapping DNAL4 protein-protein internaction.4. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: VCAM1 vascular cell adhesion molecule 1 [ Homo sapiens ]
• Official Symbol: VCAM1
• Synonyms: VCAM1; vascular cell adhesion molecule 1; vascular cell adhesion protein 1; CD106; CD106 antigen; INCAM-100; MGC99561; DKFZp779G2333
• Gene ID: 7412
• mRNA Refseq: NM_001078
• Protein Refseq: NP_001069
• MIM: 192225
• UniProt ID: P19320
• Chromosome Location: 1p32-p31
• Pathway: Adaptive Immune System, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cellular roles of Anthrax toxin, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem
• Function: cell adhesion molecule binding; cell adhesion molecule binding; integrin binding