Recombinant Human VASH2 Protein (1-355 aa), His-SUMO-tagged

Cat.No. : VASH2-1980H
Product Overview : Recombinant Human VASH2 Protein (1-355 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-355 aa
Description : Angiogenesis inhibitor. Inhibits network formation by endothelial cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 56.4 kDa
AA Sequence : MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name VASH2 vasohibin 2 [ Homo sapiens ]
Official Symbol VASH2
Synonyms VASH2; vasohibin 2; vasohibin-2; FLJ12505; RP11-275G3.1;
Gene ID 79805
mRNA Refseq NM_001136474
Protein Refseq NP_001129946
MIM 610471
UniProt ID Q86V25

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VASH2 Products

Required fields are marked with *

My Review for All VASH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon