Recombinant Human VASH2 Protein (1-355 aa), His-SUMO-tagged
Cat.No. : | VASH2-1980H |
Product Overview : | Recombinant Human VASH2 Protein (1-355 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-355 aa |
Description : | Angiogenesis inhibitor. Inhibits network formation by endothelial cells. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 56.4 kDa |
AA Sequence : | MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | VASH2 vasohibin 2 [ Homo sapiens ] |
Official Symbol | VASH2 |
Synonyms | VASH2; vasohibin 2; vasohibin-2; FLJ12505; RP11-275G3.1; |
Gene ID | 79805 |
mRNA Refseq | NM_001136474 |
Protein Refseq | NP_001129946 |
MIM | 610471 |
UniProt ID | Q86V25 |
◆ Recombinant Proteins | ||
VASH2-9997M | Recombinant Mouse VASH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
VASH2-6599H | Recombinant Human VASH2 Protein (Thr2-IIe354), C-His tagged | +Inquiry |
VASH2-17984M | Recombinant Mouse VASH2 Protein | +Inquiry |
VASH2-1980H | Recombinant Human VASH2 Protein (1-355 aa), His-SUMO-tagged | +Inquiry |
Vash2-6899M | Recombinant Mouse Vash2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASH2-427HCL | Recombinant Human VASH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VASH2 Products
Required fields are marked with *
My Review for All VASH2 Products
Required fields are marked with *
0
Inquiry Basket