Recombinant Human USP8 protein, GST-tagged

• Cat.No.: USP8-301310H
• Product Overview: Recombinant Human USP8 (15-253 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser15-Val253
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: USP8 ubiquitin specific peptidase 8 [ Homo sapiens ]
• Official Symbol: USP8
• Synonyms: USP8; ubiquitin specific peptidase 8; ubiquitin specific protease 8; ubiquitin carboxyl-terminal hydrolase 8; HumORF8; KIAA0055; UBPY; hUBPy; ubiquitin isopeptidase Y; ubiquitin thioesterase 8; deubiquitinating enzyme 8; ubiquitin thiolesterase 8; ubiquitin-specific-processing protease 8; FLJ34456; MGC129718
• Gene ID: 9101
• mRNA Refseq: NM_001128610
• Protein Refseq: NP_001122082
• MIM: 603158
• UniProt ID: P40818