Recombinant Human USP47 protein, GST-tagged

• Cat.No.: USP47-16H
• Product Overview: Recombinant Human USP47(1 a.a. - 157 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: USP47 played an important role in many functions.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44.5 kDa
• AA Sequence: MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLD WNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAP NKDLTQD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-157 a.a.

Gene Information

• Gene Name: USP47 ubiquitin specific peptidase 47 [ Homo sapiens ]
• Official Symbol: USP47
• Synonyms: USP47; ubiquitin specific peptidase 47; Trf (TATA binding protein related factor) proximal homolog (Drosophila) , ubiquitin specific protease 47; ubiquitin carboxyl-terminal hydrolase 47; ubiquitin thioesterase 47; deubiquitinating enzyme 47; ubiquitin thiolesterase 47; ubiquitin specific protease 47; ubiquitin-specific-processing protease 47; Trf (TATA binding protein-related factor)-proximal homolog; TRFP; FLJ20727; DKFZp686C13257
• Gene ID: 55031
• mRNA Refseq: NM_017944
• Protein Refseq: NP_060414
• MIM: 614460
• UniProt ID: Q96K76
• Chromosome Location: 11p15.2
• Function: WD40-repeat domain binding; cysteine-type peptidase activity; peptidase activity; protein binding; ubiquitin thiolesterase activity; ubiquitin-specific protease activity