Recombinant Human USP33 protein, GST-tagged

• Cat.No.: USP33-3015H
• Product Overview: Recombinant Human USP33 (290-472 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Glu290-Arg472
• AA Sequence: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: USP33 ubiquitin specific peptidase 33 [ Homo sapiens ]
• Official Symbol: USP33
• Synonyms: USP33; ubiquitin specific peptidase 33; ubiquitin specific protease 33; ubiquitin carboxyl-terminal hydrolase 33; KIAA1097; VDU1; hVDU1; ubiquitin thioesterase 33; deubiquitinating enzyme 33; ubiquitin thiolesterase 33; VHL-interacting deubiquitinating enzyme 1; ubiquitin-specific-processing protease 33; pVHL-interacting deubiquitinating enzyme 1; MGC16868
• Gene ID: 23032
• mRNA Refseq: NM_015017
• Protein Refseq: NP_055832
• MIM: 615146
• UniProt ID: Q8TEY7