Recombinant Human USP31, GST-tagged

• Cat.No.: USP31-710H
• Product Overview: Recombinant Human USP31 (1254 aa - 1352 aa) fused with GST-tag at N-terminal, was expressed in vitro wheat germ system.

Specification

• Cat. No.: USP31-710H
• Description: This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
• Source: wheat germ
• Molecular Mass: 36.63 kDa
• Sequence: AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Note: Best use within three months from the date of receipt of this protein.
• OfficialSymbol: USP31

Gene Information

• Gene Name: USP31 ubiquitin specific peptidase 31 [ Homo sapiens ]
• Synonyms: ubiquitin specific peptidase 31; ubiquitin carboxyl-terminal hydrolase 31; KIAA1203; ubiquitin specific proteinase 31; ubiquitin specific protease 31; ubiquitin thioesterase 31; Deubiquitinating enzyme 31; EC 3.4.19.12; Ubiquitin thiolesterase 31; EC 3.1.2.15; Ubiquitin-specific-processing protease 31; OTTHUMP00000120022
• Gene ID: 57478
• mRNA Refseq: NM_020718
• Protein Refseq: NP_065769
• UniProt ID: Q70CQ4
• Chromosome Location: 16p12.2
• Function: cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity