Recombinant Human USP29 protein, GST-tagged

Cat.No. : USP29-301296H
Product Overview : Recombinant Human USP29 (1-285 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Gln285
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name USP29 ubiquitin specific peptidase 29 [ Homo sapiens ]
Official Symbol USP29
Synonyms USP29; ubiquitin specific peptidase 29; ubiquitin specific protease 29; ubiquitin carboxyl-terminal hydrolase 29; ubiquitin thioesterase 29; deubiquitinating enzyme 29; ubiquitin thiolesterase 29; ubiquitin-specific processing protease; ubiquitin-specific-processing protease 29; HOM-TES-84/86; MGC163266; MGC163270;
Gene ID 57663
mRNA Refseq NM_020903
Protein Refseq NP_065954
MIM 609546
UniProt ID Q9HBJ7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All USP29 Products

Required fields are marked with *

My Review for All USP29 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon