Recombinant Human USP24 protein, GST-tagged

• Cat.No.: USP24-252H
• Product Overview: Recombinant Human USP24(1 a.a. - 309 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-309 a.a.
• Description: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 59.73 kDa
• AA Sequence: MISFLLGASRQNNQIRRWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAPGIFKQRPPISIAPSSPLLPLHEEVE ALLFMSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMS EHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQGSESPMMIGEL RSDLDDVDP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: USP24 ubiquitin specific peptidase 24 [ Homo sapiens ]
• Official Symbol: USP24
• Synonyms: USP24; ubiquitin specific peptidase 24; ubiquitin specific protease 24; ubiquitin carboxyl-terminal hydrolase 24; KIAA1057; ubiquitin thioesterase 24; deubiquitinating enzyme 24; ubiquitin thiolesterase 24; ubiquitin-specific processing protease 24; ubiquitin-specific-processing protease 24; FLJ31309
• Gene ID: 23358
• mRNA Refseq: NM_015306
• Protein Refseq: NP_056121
• MIM: 610569
• UniProt ID: Q9UPU5
• Chromosome Location: 1p32.3
• Function: binding; cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity