Recombinant Human USP24 protein, GST-tagged
Cat.No. : | USP24-252H |
Product Overview : | Recombinant Human USP24(1 a.a. - 309 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-309 a.a. |
Description : | Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 59.73 kDa |
AA Sequence : | MISFLLGASRQNNQIRRWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAPGIFKQRPPISIAPSSPLLPLHEEVE ALLFMSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMS EHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQGSESPMMIGEL RSDLDDVDP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | USP24 ubiquitin specific peptidase 24 [ Homo sapiens ] |
Official Symbol | USP24 |
Synonyms | USP24; ubiquitin specific peptidase 24; ubiquitin specific protease 24; ubiquitin carboxyl-terminal hydrolase 24; KIAA1057; ubiquitin thioesterase 24; deubiquitinating enzyme 24; ubiquitin thiolesterase 24; ubiquitin-specific processing protease 24; ubiquitin-specific-processing protease 24; FLJ31309; |
Gene ID | 23358 |
mRNA Refseq | NM_015306 |
Protein Refseq | NP_056121 |
MIM | 610569 |
UniProt ID | Q9UPU5 |
Chromosome Location | 1p32.3 |
Function | binding; cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity; |
◆ Recombinant Proteins | ||
Usp24-6871M | Recombinant Mouse Usp24 Protein, Myc/DDK-tagged | +Inquiry |
USP24-2325H | Recombinant Human USP24 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP24-17913M | Recombinant Mouse USP24 Protein | +Inquiry |
USP24-1162HFL | Active Recombinant Full Length Human USP24 Protein, C-Flag-tagged | +Inquiry |
USP24-32H | Recombinant Human USP24 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP24-1894HCL | Recombinant Human USP24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP24 Products
Required fields are marked with *
My Review for All USP24 Products
Required fields are marked with *
0
Inquiry Basket