Recombinant Human USP19 protein, GST-tagged

• Cat.No.: USP19-1849H
• Product Overview: Recombinant Human USP19 protein(203-500 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 203-500 aa
• AA Sequence: VEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: USP19 ubiquitin specific peptidase 19 [ Homo sapiens ]
• Official Symbol: USP19
• Synonyms: USP19; ubiquitin specific peptidase 19; ubiquitin specific protease 19; ubiquitin carboxyl-terminal hydrolase 19; KIAA0891; ZMYND9; ubiquitin thioesterase 19; deubiquitinating enzyme 19; ubiquitin thiolesterase 19; ubiquitin-specific-processing protease 19; zinc finger MYND domain-containing protein 9
• Gene ID: 10869
• mRNA Refseq: NM_001199160
• Protein Refseq: NP_001186089
• MIM: 614471
• UniProt ID: O94966