Recombinant Human USP19 protein, GST-tagged
Cat.No. : | USP19-1849H |
Product Overview : | Recombinant Human USP19 protein(203-500 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 203-500 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | VEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USP19 ubiquitin specific peptidase 19 [ Homo sapiens ] |
Official Symbol | USP19 |
Synonyms | USP19; ubiquitin specific peptidase 19; ubiquitin specific protease 19; ubiquitin carboxyl-terminal hydrolase 19; KIAA0891; ZMYND9; ubiquitin thioesterase 19; deubiquitinating enzyme 19; ubiquitin thiolesterase 19; ubiquitin-specific-processing protease 19; zinc finger MYND domain-containing protein 9; |
Gene ID | 10869 |
mRNA Refseq | NM_001199160 |
Protein Refseq | NP_001186089 |
MIM | 614471 |
UniProt ID | O94966 |
◆ Recombinant Proteins | ||
USP19-0386H | Recombinant Human USP19 Protein (E904-R1318), Tag Free | +Inquiry |
USP19-6128R | Recombinant Rat USP19 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP19-6472R | Recombinant Rat USP19 Protein | +Inquiry |
USP19-186H | Active Recombinant Human USP19, GST-tagged | +Inquiry |
USP19-1849H | Recombinant Human USP19 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP19-1893HCL | Recombinant Human USP19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP19 Products
Required fields are marked with *
My Review for All USP19 Products
Required fields are marked with *
0
Inquiry Basket