Recombinant Human USP12 protein, His-tagged
Cat.No. : | USP12-3814H |
Product Overview : | Recombinant Human USP12 protein, fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USP12 ubiquitin specific peptidase 12 [ Homo sapiens ] |
Official Symbol | USP12 |
Synonyms | USP12; ubiquitin specific peptidase 12; ubiquitin specific protease 12 , ubiquitin specific protease 12 like 1 , USP12L1; ubiquitin carboxyl-terminal hydrolase 12; ubiquitin thioesterase 12; deubiquitinating enzyme 12; ubiquitin thiolesterase 12; ubiquitin-hydrolyzing enzyme 1; ubiquitin specific protease 12 like 1; ubiquitin-specific-processing protease 12; UBH1; USP12L1; |
Gene ID | 219333 |
mRNA Refseq | NM_182488 |
Protein Refseq | NP_872294 |
UniProt ID | O75317 |
◆ Recombinant Proteins | ||
USP12-9948M | Recombinant Mouse USP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP12-3814H | Recombinant Human USP12 protein, His-tagged | +Inquiry |
USP12-79H | Recombinant Active Human USP12 Protein, GST-tagged | +Inquiry |
USP12-17901M | Recombinant Mouse USP12 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP12-473HCL | Recombinant Human USP12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP12 Products
Required fields are marked with *
My Review for All USP12 Products
Required fields are marked with *
0
Inquiry Basket