Recombinant Human UQCRH Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UQCRH-6506H
Product Overview : UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
Molecular Mass : 10.7 kDa
AA Sequence : MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UQCRH ubiquinol-cytochrome c reductase hinge protein [ Homo sapiens (human) ]
Official Symbol UQCRH
Synonyms UQCRH; ubiquinol-cytochrome c reductase hinge protein; cytochrome b-c1 complex subunit 6, mitochondrial; QCR6; ubiquinol cytochrome c reductase; complex III subunit VIII; UQCR8; complex III subunit 6; mitochondrial hinge protein; cytochrome c1 non-heme 11 kDa protein; ubiquinol-cytochrome c reductase complex 11 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VIII; MGC111572;
Gene ID 7388
mRNA Refseq NM_006004
Protein Refseq NP_005995
MIM 613844
UniProt ID P07919

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UQCRH Products

Required fields are marked with *

My Review for All UQCRH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon