Recombinant Human UQCRH Protein, GST-tagged

Cat.No. : UQCRH-145H
Product Overview : Recombinant Human UQCRH fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4.
Molecular Mass : 37.5kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMGLEDEQKMLTESGDPEEEEEEEEE
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name UQCRH ubiquinol-cytochrome c reductase hinge protein [ Homo sapiens ]
Official Symbol UQCRH
Synonyms UQCRH; ubiquinol-cytochrome c reductase hinge protein; cytochrome b-c1 complex subunit 6, mitochondrial; QCR6; ubiquinol cytochrome c reductase; complex III subunit VIII; UQCR8; complex III subunit 6; mitochondrial hinge protein; cytochrome c1 non-heme 11 kDa protein; ubiquinol-cytochrome c reductase complex 11 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VIII; MGC111572;
Gene ID 7388
mRNA Refseq NM_006004
Protein Refseq NP_005995
MIM 613844
UniProt ID P07919

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UQCRH Products

Required fields are marked with *

My Review for All UQCRH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon