Recombinant Human UNC5C protein, GST-tagged

Cat.No. : UNC5C-3599H
Product Overview : Recombinant Human UNC5C protein(492-597 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability March 31, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 492-597 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : PLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMR
Gene Name UNC5C unc-5 homolog C (C. elegans) [ Homo sapiens ]
Official Symbol UNC5C
Synonyms UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3;
Gene ID 8633
mRNA Refseq NM_003728
Protein Refseq NP_003719
MIM 603610
UniProt ID O95185

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UNC5C Products

Required fields are marked with *

My Review for All UNC5C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon