Recombinant Human UNC119B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UNC119B-5286H
• Product Overview: UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: UNC119B (Unc-119 Lipid Binding Chaperone B) is a Protein Coding gene. Diseases associated with UNC119B include Joubert Syndrome 22 and Retinitis Pigmentosa 2. Among its related pathways are Organelle biogenesis and maintenance and Cargo trafficking to the periciliary membrane. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is UNC119.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 28 kDa
• AA Sequence: MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UNC119B unc-119 lipid binding chaperone B [ Homo sapiens (human) ]
• Official Symbol: UNC119B
• Synonyms: UNC119B; unc-119 homolog B; unc119 (C.elegans) homolog B; MGC5139; POC7 centriolar protein homolog B (Chlamydomonas); POC7B
• Gene ID: 84747
• mRNA Refseq: NM_001080533
• Protein Refseq: NP_001074002
• UniProt ID: A6NIH7