Recombinant Human UNC119 Protein (1-240 aa), His-SUMO-tagged
Cat.No. : | UNC119-1990H |
Product Overview : | Recombinant Human UNC119 Protein (1-240 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-240 aa |
Description : | Involved in synaptic functions in photoreceptor cells, the signal transduction in immune cells as a Src family kinase activator, endosome recycling, the uptake of bacteria and endocytosis, protein trafficking in sensory neurons and as lipid-binding chaperone with specificity for a diverse subset of myristoylated proteins. Specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Probably plays a role in trafficking proteins in photoreceptor cells. Plays important roles in mediating Src family kinase signals for the completion of cytokinesis via RAB11A. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.0 kDa |
AA Sequence : | MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | UNC119 unc-119 homolog (C. elegans) [ Homo sapiens ] |
Official Symbol | UNC119 |
Synonyms | UNC119; HRG4; POC7; POC7A; retinal protein 4; |
Gene ID | 9094 |
mRNA Refseq | NM_005148 |
Protein Refseq | NP_005139 |
UniProt ID | Q13432 |
◆ Recombinant Proteins | ||
Unc119-6835M | Recombinant Mouse Unc119 Protein, Myc/DDK-tagged | +Inquiry |
UNC119-6099R | Recombinant Rat UNC119 Protein, His (Fc)-Avi-tagged | +Inquiry |
UNC119-6443R | Recombinant Rat UNC119 Protein | +Inquiry |
UNC119-3048H | Recombinant Human UNC119 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UNC119-1990H | Recombinant Human UNC119 Protein (1-240 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UNC119-502HCL | Recombinant Human UNC119 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UNC119 Products
Required fields are marked with *
My Review for All UNC119 Products
Required fields are marked with *
0
Inquiry Basket