Recombinant Human ULBP2 protein, His-tagged

• Cat.No.: ULBP2-4018H
• Product Overview: Recombinant Human ULBP2 protein(25-224 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 25-224 aa
• AA Sequence: AGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ULBP2 UL16 binding protein 2 [ Homo sapiens ]
• Official Symbol: ULBP2
• Synonyms: ULBP2; UL16 binding protein 2; NKG2D ligand 2; RAET1H; N2DL-2; NKG2DL2; ALCAN-alpha; UL16-binding protein 2; retinoic acid early transcript 1H; retinoic acid early transcript 1 H; N2DL2
• Gene ID: 80328
• mRNA Refseq: NM_025217
• Protein Refseq: NP_079493
• MIM: 605698
• UniProt ID: Q9BZM5