Recombinant Human ULBP1 Protein (Gly26-Pro215), C-Fc-tagged

• Cat.No.: VAC14-03H
• Product Overview: Human VAC14 partial ORF ( NP_060522.3, 714 a.a. - 782 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 714-782
• Description: This gene encodes a scaffold protein that is a component of the PIKfyve protein kinase complex. This complex is responsible for the synthesis of phosphatidylinositol 3,5-bisphosphate, an important component of cellular membranes, from phosphatidylinositol 3-phosphate. Mice lacking a functional copy of this gene exhibit severe neurodegeneration. Mutations in the human gene have been identified in patients with a childhood onset progressive neurological disorder characterized by impaired movement, dystonia, and striatal abnormalities.
• Molecular Mass: 33.33 kDa
• AA Sequence: SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: VAC14 VAC14 component of PIKFYVE complex [ Homo sapiens (human) ]
• Official Symbol: VAC14
• Synonyms: VAC14; VAC14 component of PIKFYVE complex; TRX; TAX1BP2; ArPIKfyve; protein VAC14 homolog; Vac14, PIKFYVE complex component
• Gene ID: 55697
• mRNA Refseq: NM_018052
• Protein Refseq: NP_060522
• MIM: 604632
• UniProt ID: Q08AM6