Recombinant Human UGT2B7 protein, His-tagged

• Cat.No.: UGT2B7-2431H
• Product Overview: Recombinant Human UGT2B7 protein(25-351 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 25-351 aa
• AA Sequence: KVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide B7 [ Homo sapiens ]
• Official Symbol: UGT2B7
• Synonyms: UGT2B7; UDP glucuronosyltransferase 2 family, polypeptide B7; UDP glycosyltransferase 2 family, polypeptide B7; UDP-glucuronosyltransferase 2B7; UGT2B9; UDPGTh-2; UDPGT 2B7; 3,4-catechol estrogen specific; UDP glucuronosyltransferase 2B7; UDP-glucuronosyltransferase 2B9; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-7; UDPGTH2; UDPGT2B7; UDPGT 2B9
• Gene ID: 7364
• mRNA Refseq: NM_001074
• Protein Refseq: NP_001065
• MIM: 600068
• UniProt ID: P16662