Recombinant Human UGT2B17 Full Length Transmembrane protein, His-tagged

• Cat.No.: UGT2B17-173H
• Product Overview: Recombinant Human UGT2B17 protein(O75795)(24-530aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 64.5 kDa
• Protein length: 24-530aa
• AA Sequence: GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: UGT2B17 UDP glucuronosyltransferase 2 family, polypeptide B17 [ Homo sapiens ]
• Official Symbol: UGT2B17
• Synonyms: UGT2B17; UDP glucuronosyltransferase 2 family, polypeptide B17; UDP glycosyltransferase 2 family, polypeptide B17; UDP-glucuronosyltransferase 2B17; C19-steroid-specific UDPGT; UDP glycosyltransferase 2 family, member B17; UDP-glucuronyltransferase, family 2, beta-17; C19-steroid-specific UDP-glucuronosyltransferase; UDPGT2B17
• Gene ID: 7367
• mRNA Refseq: NM_001077
• Protein Refseq: NP_001068
• MIM: 601903
• UniProt ID: O75795