Recombinant Human UGP2 protein, His-SUMO-tagged

• Cat.No.: UGP2-4414H
• Product Overview: Recombinant Human UGP2 protein(Q16851)(1-497aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 71.7 kDa
• Protein length: 1-497aa
• AA Sequence: MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: UGP2 UDP-glucose pyrophosphorylase 2 [ Homo sapiens ]
• Official Symbol: UGP2
• Synonyms: UGP2; UDP-glucose pyrophosphorylase 2; UDP glucose pyrophosphorylase 1 , UGP1; UTP--glucose-1-phosphate uridylyltransferase; UGPP1; UDPGP; UGPase 2; UDP-glucose diphosphorylase; UDP-glucose pyrophosphorylase 1; UTP-glucose-1-phosphate uridyltransferase; UTP--glucose-1-phosphate uridylyltransferase 2; uridyl diphosphate glucose pyrophosphorylase 2; UDPG; UGP1; UGPP2; UDPGP2; pHC379
• Gene ID: 7360
• mRNA Refseq: NM_001001521
• Protein Refseq: NP_001001521
• MIM: 191760
• UniProt ID: Q16851