Recombinant Human UCHL1 protein(61-150 aa), C-His-tagged

• Cat.No.: UCHL1-2619H
• Product Overview: Recombinant Human UCHL1 protein(P09936)(61-150 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 61-150 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 13 kDa
• AASequence: NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ]
• Official Symbol: UCHL1
• Synonyms: UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5
• Gene ID: 7345
• mRNA Refseq: NM_004181
• Protein Refseq: NP_004172
• MIM: 191342
• UniProt ID: P09936