Recombinant Human UCHL1 protein(61-150 aa), C-His-tagged
Cat.No. : | UCHL1-2619H |
Product Overview : | Recombinant Human UCHL1 protein(P09936)(61-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-150 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 13 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEG |
Gene Name | UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ] |
Official Symbol | UCHL1 |
Synonyms | UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5; |
Gene ID | 7345 |
mRNA Refseq | NM_004181 |
Protein Refseq | NP_004172 |
MIM | 191342 |
UniProt ID | P09936 |
◆ Recombinant Proteins | ||
UCHL1-1340S | Recombinant Human UCHL1 Protein (Q2-A223), Tag Free | +Inquiry |
UCHL1-9868M | Recombinant Mouse UCHL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCHL1-3608C | Recombinant Chicken UCHL1 | +Inquiry |
UCHL1-2302H | Recombinant Human UCHL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCHL1-1339S | Recombinant Human UCHL1 Protein (Q2-A223), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCHL1-535HCL | Recombinant Human UCHL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UCHL1 Products
Required fields are marked with *
My Review for All UCHL1 Products
Required fields are marked with *
0
Inquiry Basket