Recombinant Human UCHL1 protein, T7/His-tagged

• Cat.No.: UCHL1-227H
• Product Overview: Recombinant human UCHL1 cDNA (1 – 220 aa, derived from BC005117) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 1-220 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPAC ALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETE KMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDA AKVCREFTEREQGEVRFSAVALC
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ]
• Official Symbol: UCHL1
• Synonyms: UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5
• Gene ID: 7345
• mRNA Refseq: NM_004181
• Protein Refseq: NP_004172
• MIM: 191342
• UniProt ID: P09936
• Chromosome Location: 4p13
• Pathway: Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem
• Function: alpha-2A adrenergic receptor binding; cysteine-type endopeptidase activity; ligase activity; omega peptidase activity; peptidase activity; protein binding; ubiquitin binding; ubiquitin thiolesterase activity