Recombinant Human UBXN8 Protein, GST-tagged

• Cat.No.: UBXN8-2311H
• Product Overview: Human D8S2298E partial ORF ( NP_005662, 173 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: p97 or VCP (valosin-containing protein) is a versatile ATPase complex, and many cofactors are required for the p97 functional diversity. This gene encodes one of the p97 cofactors. This cofactor is a transmembrane protein and localized in the endoplasmic reticulum (ER) membrane. It tethers p97 to the ER membrane via its UBX domain. The association of this cofactor with p97 facilitates efficient ER-associated degradation of misfolded proteins. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.3 kDa
• AA Sequence: TCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBXN8 UBX domain protein 8 [ Homo sapiens (human) ]
• Official Symbol: UBXN8
• Synonyms: UBXN8; UBX domain protein 8; UBX Domain Protein 8; UBX Domain-Containing Protein 6; Reproduction 8 Protein; Rep-8 Protein; D8S2298E; UBXD6; REP8; UBX Domain-Containing Protein 8; Reproduction/Chromosome 8; UBX Domain Containing 6; UBX domain-containing protein 8; Reproduction/chromosome 8; UBX domain-containing protein 6; rep-8 protein; reproduction 8 protein
• Gene ID: 7993
• mRNA Refseq: NM_001282189
• Protein Refseq: NP_001269118
• MIM: 602155
• UniProt ID: O00124