Recombinant Human UBR1 Protein, GST-tagged

• Cat.No.: UBR1-08H
• Product Overview: Human UBR1 partial ORF ( NP_777576, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome.
• Molecular Mass: 36.63 kDa
• AA Sequence: ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBR1 ubiquitin protein ligase E3 component n-recognin 1 [ Homo sapiens (human) ]
• Official Symbol: UBR1
• Synonyms: UBR1; ubiquitin protein ligase E3 component n-recognin 1; JBS; E3 ubiquitin-protein ligase UBR1; E3a ligase; N-recognin-1; RING-type E3 ubiquitin transferase UBR1; ubiquitin ligase E3 alpha-I; ubiquitin-protein ligase E3-alpha; ubiquitin-protein ligase E3-alpha-1; ubiquitin-protein ligase E3-alpha-I; EC 2.3.2.27
• Gene ID: 197131
• mRNA Refseq: NM_174916
• Protein Refseq: NP_777576
• MIM: 605981
• UniProt ID: Q8IWV7