Recombinant Human UBL3, His-tagged

Cat.No. : UBL3-31553TH
Product Overview : Recombinant full length Human UBL3 with an N terminal His tag; 134 amino acids with tag, MWt 15 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 114 amino acids
Description : Ubiquitin-like protein 3 is a protein that in humans is encoded by the UBL3 gene.
Conjugation : HIS
Molecular Weight : 15.000kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC
Sequence Similarities : Contains 1 ubiquitin-like domain.
Gene Name UBL3 ubiquitin-like 3 [ Homo sapiens ]
Official Symbol UBL3
Synonyms UBL3; ubiquitin-like 3; PNSC1; ubiquitin-like protein 3; DKFZP434K151; FLJ32018; HCG 1;
Gene ID 5412
mRNA Refseq NM_007106
Protein Refseq NP_009037
MIM 604711
Uniprot ID O95164
Chromosome Location 13q12-q13

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UBL3 Products

Required fields are marked with *

My Review for All UBL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon