Recombinant Human UBE4B, GST-tagged

• Cat.No.: UBE4B-3553H
• Product Overview: Recombinant Human UBE4B( 1075 a.a. - 1173 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Molecular Mass: 36.63 kDa
• AA Sequence: FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTES MLEPVPELKEQIQAWMREKQNSDH
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBE4B ubiquitination factor E4B [ Homo sapiens (human) ]
• Official Symbol: UBE4B
• Synonyms: UBE4B; E4; UFD2; HDNB1; UBOX3; UFD2A; ubiquitination factor E4B; ubiquitin conjugation factor E4 B; homologous to yeast UFD2; UFD2A-III/UBE4B-III splice isoform; ubiquitin fusion degradation protein 2; ubiquitin-fusion degradation protein 2; homozygously deleted in neuroblastoma 1; homozygously deleted in neuroblastoma-1; ubiquitination factor E4B (UFD2 homolog, yeast); ubiquitination factor E4B (homologous to yeast UFD2)
• Gene ID: 10277
• mRNA Refseq: NM_006048
• Protein Refseq: NP_006039
• MIM: 613565
• UniProt ID: O95155
• Chromosome Location: 1p36.3
• Pathway: Protein processing in endoplasmic reticulum; Ubiquitin mediated proteolysis
• Function: enzyme binding; ubiquitin-ubiquitin ligase activity