Recombinant Human UBE3C Protein (599-698), N-GST tagged

• Cat.No.: UBE3C-06H
• Product Overview: Human UBE3C partial ORF (NP_055486, 599-698 a.a.) recombinant protein with GST-tag at N-terminal ws expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 599-698
• Description: Enables ubiquitin protein ligase activity. Involved in protein polyubiquitination. Predicted to be located in nucleus. Predicted to be part of proteasome complex.
• Molecular Mass: 36.74 kDa
• AA Sequence: IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEER
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Gene Information

• Gene Name: UBE3C ubiquitin protein ligase E3C [ Homo sapiens (human) ]
• Official Symbol: UBE3C
• Synonyms: UBE3C; ubiquitin protein ligase E3C; RAUL; HECTH2; NDSMBA; NEDSMBA; ubiquitin-protein ligase E3C; HECT-type ubiquitin transferase E3C; RTA-associated ubiquitin ligase; homologous to E6AP carboxyl terminus homologous protein 2; ubiquitin-protein isopeptide ligase (E3); EC 2.3.2.26
• Gene ID: 9690
• mRNA Refseq: NM_014671
• Protein Refseq: NP_055486
• MIM: 614454
• UniProt ID: Q15386