Recombinant Human UBE3A protein, GST-tagged

• Cat.No.: UBE3A-3550H
• Product Overview: Recombinant Human UBE3A protein(9-215 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 9-215 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: UBE3A
• Synonyms: UBE3A; ubiquitin protein ligase E3A; EPVE6AP, HPVE6A, human papilloma virus E6 associated protein; ubiquitin-protein ligase E3A; ANCR; Angelman syndrome; AS; E6 AP; FLJ26981; CTCL tumor antigen se37-2; E6AP ubiquitin-protein ligase; renal carcinoma antigen NY-REN-54; human papillomavirus E6-associated protein; oncogenic protein-associated protein E6-AP; human papilloma virus E6-associated protein; E6-AP; HPVE6A; EPVE6AP
• Gene ID: 7337
• mRNA Refseq: NM_000462
• Protein Refseq: NP_000453
• MIM: 601623
• UniProt ID: Q05086