Recombinant Human UBE2I protein, GST-tagged

• Cat.No.: UBE2I-002H
• Product Overview: Recombinant Human UBE2I fused with GST tag at N-terminal was expressed in E.coli.

Specification

• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: Supplied as a 0.2 µM filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5
• Molecular Mass: 44.4kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVP
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: UBE2I ubiquitin conjugating enzyme E2I [ Homo sapiens (human) ]
• Official Symbol: UBE2I
• Synonyms: P18; UBC9; C358B7.1;SUMO-conjugating enzyme UBC9; RING-type E3 SUMO transferase UBC9; SUMO-protein ligase; Ubiquitin carrier protein 9; Ubiquitin carrier protein I; Ubiquitin-conjugating enzyme E2 I; Ubiquitin-protein ligase I; UBE2I
• Gene ID: 7329
• mRNA Refseq: NM_194261
• Protein Refseq: NP_919237
• MIM: 601661
• UniProt ID: P63279