Recombinant Human UBE2I Protein, 1-158aa, GST-tagged

Description :	The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.
Source :	E. coli
Species :	Human
Tag :	GST
Protein length :	1-158 a.a.
Molecular Mass :	~ 44.8KDa, reducing conditions
AA Sequence :	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Purity :	> 90% as determined by SDS-PAGE
Storage :	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration :	0.54 mg/mL
Storage Buffer :	Supplied as a 0.2 μm filtered solution in PBS, pH 8.0

Gene Name	UBE2I ubiquitin conjugating enzyme E2 I [ Homo sapiens (human) ]
Official Symbol	UBE2I
Synonyms	UBE2I; ubiquitin conjugating enzyme E2 I; P18; UBC9; C358B7.1; SUMO-conjugating enzyme UBC9; ; RING-type E3 SUMO transferase UBC9; SUMO-1-protein ligase; SUMO-protein ligase; ubiquitin carrier protein 9; ubiquitin carrier protein I; ubiquitin conjugating enzyme 9; ubiquitin conjugating enzyme E2I; ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast); ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9); ubiquitin-conjugating enzyme UbcE2A; ubiquitin-like protein SUMO-1 conjugating enzyme; ubiquitin-protein ligase E2I; ubiquitin-protein ligase I; ; EC 6.3.2.19
Gene ID	7329
mRNA Refseq	NM_194259
Protein Refseq	NP_919235
MIM	601661
UniProt ID	P63279