Recombinant Human UBE2E2 protein, His-tagged

Cat.No. : UBE2E2-310H
Product Overview : Recombinant Human UBE2E2 protein(O00635)(Ser11-Lys120), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ser11-Lys120
Tag : C-His
Form : Phosphate buffered saline.
Molecular Mass : 14 KDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
Gene Name UBE2E2 ubiquitin-conjugating enzyme E2E 2 [ Homo sapiens ]
Official Symbol UBE2E2
Synonyms UBE2E2; ubiquitin-conjugating enzyme E2E 2; ubiquitin conjugating enzyme E2E 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 E2; FLJ25157; UbcH8; ubiquitin-protein ligase E2; ubiquitin carrier protein E2; ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5); UBCH8;
Gene ID 7325
mRNA Refseq NM_152653
Protein Refseq NP_689866
MIM 602163
UniProt ID Q96LR5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UBE2E2 Products

Required fields are marked with *

My Review for All UBE2E2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon