Recombinant Human UBE2E1 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: UBE2E1-174H
• Product Overview: UBE2E1 MS Standard C13 and N15-labeled recombinant protein (NP_872607) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.3 kDa
• AA Sequence: MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UBE2E1 ubiquitin conjugating enzyme E2 E1 [ Homo sapiens (human) ]
• Official Symbol: UBE2E1
• Synonyms: UBE2E1; ubiquitin conjugating enzyme E2 E1; UBCH6; ubiquitin-conjugating enzyme E2 E1; (E3-independent) E2 ubiquitin-conjugating enzyme E1; E2 ubiquitin-conjugating enzyme E1; ubiquitin carrier protein E1; ubiquitin conjugating enzyme E2E 1; ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 1 (homologous to yeast UBC4/5); ubiquitin-protein ligase E1; EC 2.3.2.23; EC 2.3.2.24
• Gene ID: 7324
• mRNA Refseq: NM_182666
• Protein Refseq: NP_872607
• MIM: 602916
• UniProt ID: P51965