Recombinant Human UBE2E1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBE2E1-174H |
Product Overview : | UBE2E1 MS Standard C13 and N15-labeled recombinant protein (NP_872607) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBE2E1 ubiquitin conjugating enzyme E2 E1 [ Homo sapiens (human) ] |
Official Symbol | UBE2E1 |
Synonyms | UBE2E1; ubiquitin conjugating enzyme E2 E1; UBCH6; ubiquitin-conjugating enzyme E2 E1; (E3-independent) E2 ubiquitin-conjugating enzyme E1; E2 ubiquitin-conjugating enzyme E1; ubiquitin carrier protein E1; ubiquitin conjugating enzyme E2E 1; ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 1 (homologous to yeast UBC4/5); ubiquitin-protein ligase E1; EC 2.3.2.23; EC 2.3.2.24 |
Gene ID | 7324 |
mRNA Refseq | NM_182666 |
Protein Refseq | NP_872607 |
MIM | 602916 |
UniProt ID | P51965 |
◆ Recombinant Proteins | ||
UBE2E1-852H | Recombinant Human UBE2E1, None tagged | +Inquiry |
UBE2E1-0016H | Recombinant Human UBE2E1 Protein (S2-T193), His/Strep tagged | +Inquiry |
UBE2E1-9825M | Recombinant Mouse UBE2E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2E1-174H | Recombinant Human UBE2E1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBE2E1-5955Z | Recombinant Zebrafish UBE2E1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2E1 Products
Required fields are marked with *
My Review for All UBE2E1 Products
Required fields are marked with *
0
Inquiry Basket