Recombinant Human UBB Protein, GST-6His-tagged
Cat.No. : | UBB-613H |
Product Overview : | Recombinant Human UBB fused with N-terminal GST-6His was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Description : | This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. An aberrant form of this protein has been detected in patients with Alzheimer's disease and Down syndrome. Pseudogenes of this gene are located on chromosomes 1, 2, 13, and 17. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4. |
Molecular Mass : | 40.9kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKF |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | UBB ubiquitin B [ Homo sapiens ] |
Official Symbol | UBB |
Synonyms | UBB; ubiquitin B; polyubiquitin-B; FLJ25987; MGC8385; polyubiquitin B; UBC; UBA52; RPS27A; |
Gene ID | 7314 |
mRNA Refseq | NM_018955 |
Protein Refseq | NP_061828 |
MIM | 191339 |
UniProt ID | P0CG47 |
◆ Recombinant Proteins | ||
UBB-03H | Active Recombinant Human Ubiquitin AMC Protein | +Inquiry |
UBB-9817M | Recombinant Mouse UBB Protein, His (Fc)-Avi-tagged | +Inquiry |
UBB-614H | Recombinant Human UBB Protein, His-tagged | +Inquiry |
UBB-5052R | Recombinant Rhesus monkey UBB Protein, His-tagged | +Inquiry |
UBB-2079Z | Recombinant Zebrafish UBB | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBB Products
Required fields are marked with *
My Review for All UBB Products
Required fields are marked with *
0
Inquiry Basket