Recombinant Human UBALD1 Protein, GST-tagged

• Cat.No.: UBALD1-3659H
• Product Overview: Human FAM100A full-length ORF ( NP_660296.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: UBALD1 (UBA Like Domain Containing 1) is a Protein Coding gene. An important paralog of this gene is UBALD2.
• Molecular Mass: 45.4 kDa
• AA Sequence: MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBALD1 UBA like domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: UBALD1
• Synonyms: UBA Like Domain Containing 1; Family With Sequence Similarity 100, Member A; FAM100A; UBA-Like Domain-Containing Protein 1; UBA-Like Domain Containing 1; Protein FAM100A; PP11303; UBA-like domain-containing protein 1; family with sequence similarity 100, member A; protein FAM100A
• Gene ID: 124402
• mRNA Refseq: NM_001330467
• Protein Refseq: NP_001317396
• UniProt ID: Q8TB05