Recombinant Human UBAC2 protein, His-tagged

• Cat.No.: UBAC2-141H
• Product Overview: Recombinant Human UBAC2 protein(NP_001137544)(18-231 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 18-231 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: LAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: UBAC2 UBA domain containing 2 [ Homo sapiens ]
• Official Symbol: UBAC2
• Synonyms: UBAC2; UBA domain containing 2; PHGDHL1, phosphoglycerate dehydrogenase like 1; ubiquitin-associated domain-containing protein 2; FLJ30548; RP11 178C10.1; RP11-178C10.1; UBA domain-containing protein 2; phosphoglycerate dehydrogenase like 1; phosphoglycerate dehydrogenase-like protein 1; PHGDHL1; FLJ26351; FLJ30001; FLJ42413; MGC90487
• Gene ID: 337867
• mRNA Refseq: NM_001144072
• Protein Refseq: NP_001137544
• UniProt ID: Q8NBM4