Recombinant Human UBA6 Protein, GST-tagged

• Cat.No.: UBA6-4225H
• Product Overview: Human FLJ10808 full-length ORF ( AAH31637, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 68.31 kDa
• AA Sequence: MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBA6 ubiquitin-like modifier activating enzyme 6 [ Homo sapiens ]
• Official Symbol: UBA6
• Synonyms: UBA6; ubiquitin-like modifier activating enzyme 6; UBE1L2, ubiquitin activating enzyme E1 like 2; ubiquitin-like modifier-activating enzyme 6; FLJ10808; ubiquitin activating enzyme E1; monocyte protein 4; ubiquitin-activating enzyme 6; UBA6, ubiquitin-activating enzyme E1; ubiquitin-activating enzyme E1-like 2; ubiquitin-activating enzyme E1-like protein 2; E1-L2; MOP-4; UBE1L2; FLJ23367
• Gene ID: 55236
• mRNA Refseq: NM_018227
• Protein Refseq: NP_060697
• MIM: 611361
• UniProt ID: A0AVT1