Recombinant Human TYROBP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TYROBP-4167H |
Product Overview : | TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Mass : | 12.2 kDa |
AA Sequence : | MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TYROBP TYRO protein tyrosine kinase binding protein [ Homo sapiens (human) ] |
Official Symbol | TYROBP |
Synonyms | TYROBP; TYRO protein tyrosine kinase binding protein; PLOSL; TYRO protein tyrosine kinase-binding protein; DAP12; DNAX activation protein 12; KARAP; killer activating receptor associated protein; PLO SL; KAR-associated protein; DNAX-activation protein 12; killer-activating receptor-associated protein; |
Gene ID | 7305 |
mRNA Refseq | NM_003332 |
Protein Refseq | NP_003323 |
MIM | 604142 |
UniProt ID | O43914 |
◆ Recombinant Proteins | ||
TYROBP-17675M | Recombinant Mouse TYROBP Protein | +Inquiry |
TYROBP-5873Z | Recombinant Zebrafish TYROBP | +Inquiry |
RFL1735MF | Recombinant Full Length Mouse Tyro Protein Tyrosine Kinase-Binding Protein(Tyrobp) Protein, His-Tagged | +Inquiry |
RFL7785HF | Recombinant Full Length Human Tyro Protein Tyrosine Kinase-Binding Protein(Tyrobp) Protein, His-Tagged | +Inquiry |
TYROBP-4857R | Recombinant Rhesus Macaque TYROBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
TYROBP-614HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TYROBP Products
Required fields are marked with *
My Review for All TYROBP Products
Required fields are marked with *
0
Inquiry Basket