Recombinant Human TYROBP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TYROBP-4167H
• Product Overview: TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.2 kDa
• AA Sequence: MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TYROBP TYRO protein tyrosine kinase binding protein [ Homo sapiens (human) ]
• Official Symbol: TYROBP
• Synonyms: TYROBP; TYRO protein tyrosine kinase binding protein; PLOSL; TYRO protein tyrosine kinase-binding protein; DAP12; DNAX activation protein 12; KARAP; killer activating receptor associated protein; PLO SL; KAR-associated protein; DNAX-activation protein 12; killer-activating receptor-associated protein
• Gene ID: 7305
• mRNA Refseq: NM_003332
• Protein Refseq: NP_003323
• MIM: 604142
• UniProt ID: O43914