Recombinant Human TYR protein(281-360 aa), C-His-tagged
Cat.No. : | TYR-2655H |
Product Overview : | Recombinant Human TYR protein(P14679)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 281-360 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS |
Gene Name | TYR tyrosinase (oculocutaneous albinism IA) [ Homo sapiens ] |
Official Symbol | TYR |
Synonyms | TYR; tyrosinase (oculocutaneous albinism IA); tyrosinase; OCAIA; LB24-AB; SK29-AB; monophenol monooxygenase; tumor rejection antigen AB; CMM8; OCA1A; SHEP3; |
Gene ID | 7299 |
mRNA Refseq | NM_000372 |
Protein Refseq | NP_000363 |
MIM | 606933 |
UniProt ID | P14679 |
◆ Recombinant Proteins | ||
Tyr-6757M | Recombinant Mouse Tyr Protein, Myc/DDK-tagged | +Inquiry |
RFL12878MF | Recombinant Full Length Mouse Tyrosinase(Tyr) Protein, His-Tagged | +Inquiry |
RFL5091OF | Recombinant Full Length Oryzias Latipes Tyrosinase(Tyr) Protein, His-Tagged | +Inquiry |
TYR-5736C | Recombinant Chicken TYR | +Inquiry |
TYR-1551H | Recombinant Human TYR Protein (19-377 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYR-1869HCL | Recombinant Human TYR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TYR Products
Required fields are marked with *
My Review for All TYR Products
Required fields are marked with *
0
Inquiry Basket