Recombinant Human TYR protein(281-360 aa), C-His-tagged

• Cat.No.: TYR-2655H
• Product Overview: Recombinant Human TYR protein(P14679)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 281-360 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: EYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TYR tyrosinase (oculocutaneous albinism IA) [ Homo sapiens ]
• Official Symbol: TYR
• Synonyms: TYR; tyrosinase (oculocutaneous albinism IA); tyrosinase; OCAIA; LB24-AB; SK29-AB; monophenol monooxygenase; tumor rejection antigen AB; CMM8; OCA1A; SHEP3
• Gene ID: 7299
• mRNA Refseq: NM_000372
• Protein Refseq: NP_000363
• MIM: 606933
• UniProt ID: P14679