Recombinant Human TXNL4A protein, His-tagged

• Cat.No.: TXNL4A-3795H
• Product Overview: Recombinant Human TXNL4A protein(1 - 142 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1 - 142 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TXNL4A thioredoxin-like 4A [ Homo sapiens ]
• Official Symbol: TXNL4A
• Synonyms: TXNL4A; thioredoxin-like 4A; thioredoxin like 4 , TXNL4; thioredoxin-like protein 4A; DIB1; DIM1; HsT161; similar to S. pombe dim1+; U5 15kD; thioredoxin-like 4; DIM1 protein homolog; thioredoxin-like U5 snRNP protein U5-15kD; spliceosomal U5 snRNP-specific 15 kDa protein; TXNL4; U5-15kD
• Gene ID: 10907
• mRNA Refseq: NM_006701
• Protein Refseq: NP_006692
• MIM: 611595
• UniProt ID: P83876