Recombinant Human TXNDC9 protein, GST-tagged

• Cat.No.: TXNDC9-1800H
• Product Overview: Recombinant Human TXNDC9 protein(1-226 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-226 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TXNDC9 thioredoxin domain containing 9 [ Homo sapiens ]
• Official Symbol: TXNDC9
• Synonyms: TXNDC9; thioredoxin domain containing 9; thioredoxin domain-containing protein 9; APACD; protein 1-4; ATP binding protein associated with cell differentiation; ATP-binding protein associated with cell differentiation; PHLP3
• Gene ID: 10190
• mRNA Refseq: NM_005783
• Protein Refseq: NP_005774
• MIM: 612564
• UniProt ID: O14530