Recombinant Human TXN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TXN-2132H |
Product Overview : | TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TXN thioredoxin [ Homo sapiens (human) ] |
Official Symbol | TXN |
Synonyms | TXN; thioredoxin; TRX; ADF; SASP; TXN delta 3; ATL-derived factor; thioredoxin delta 3; surface-associated sulphydryl protein; TRDX; TRX1; MGC61975; DKFZp686B1993; |
Gene ID | 7295 |
mRNA Refseq | NM_003329 |
Protein Refseq | NP_003320 |
MIM | 187700 |
UniProt ID | P10599 |
◆ Recombinant Proteins | ||
TXN-220H | Recombinant Human TXN Protein, His\Avi-tagged | +Inquiry |
TXN-019H | Recombinant Human TXN Protein | +Inquiry |
TXN-2556H | Active Recombinant Human TXN protein(Met1-Val105) | +Inquiry |
TXN-6524H | Recombinant Human TXN Protein (Val2-Val105), N-His tagged | +Inquiry |
TXN-2282H | Recombinant Human TXN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXN-627HCL | Recombinant Human TXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXN Products
Required fields are marked with *
My Review for All TXN Products
Required fields are marked with *
0
Inquiry Basket