Recombinant Human TWISTNB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TWISTNB-5303H |
Product Overview : | TWISTNB MS Standard C13 and N15-labeled recombinant protein (NP_001002926) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Through its association with RRN3/TIF-IA may be involved in recruitment of Pol I to rDNA promoters. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKKKKKHQEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEAEFTPPLKCSPKRKGKSNFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TWISTNB TWIST neighbor [ Homo sapiens (human) ] |
Official Symbol | TWISTNB |
Synonyms | TWISTNB; TWIST neighbor; DNA-directed RNA polymerase I subunit RPA43; twist neighbor protein; |
Gene ID | 221830 |
mRNA Refseq | NM_001002926 |
Protein Refseq | NP_001002926 |
MIM | 608312 |
UniProt ID | Q3B726 |
◆ Recombinant Proteins | ||
TWISTNB-4424C | Recombinant Chicken TWISTNB | +Inquiry |
TWISTNB-1647Z | Recombinant Zebrafish TWISTNB | +Inquiry |
TWISTNB-3495H | Recombinant Human TWISTNB, His-tagged | +Inquiry |
TWISTNB-5303H | Recombinant Human TWISTNB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWISTNB-630HCL | Recombinant Human TWISTNB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TWISTNB Products
Required fields are marked with *
My Review for All TWISTNB Products
Required fields are marked with *
0
Inquiry Basket