Recombinant Human TUSC2 protein, GST-tagged

• Cat.No.: TUSC2-3637H
• Product Overview: Recombinant Human TUSC2 protein(O75896)(1-110aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-110aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.9 kDa
• AA Sequence: GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TUSC2 tumor suppressor candidate 2 [ Homo sapiens ]
• Official Symbol: TUSC2
• Synonyms: TUSC2; tumor suppressor candidate 2; PDAP2, PDGFA associated protein 2; C3orf11; FUS1; PAP; fus-1 protein; fusion 1 protein; PDGFA associated protein 2; PDGFA-associated protein 2; PDAP2
• Gene ID: 11334
• mRNA Refseq: NM_007275
• Protein Refseq: NP_009206
• MIM: 607052
• UniProt ID: O75896